GJB1 antibody (C-Term)

Catalog No. ABIN630257

Product Details anti-GJB1 Antibody

Target: GJB1 (Gap Junction Protein, beta 1, 32kDa (GJB1))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GJB1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: GJB1 antibody was raised against the C terminal of GJB1

Purification: Purified

Immunogen: GJB1 antibody was raised using the C terminal of GJB1 corresponding to a region with amino acids GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJB1 Blocking Peptide, catalog no. 33R-3256, is also available for use as a blocking control in assays to test for specificity of this GJB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GJB1

Target: GJB1 (Gap Junction Protein, beta 1, 32kDa (GJB1))

Alternative Name: GJB1 (GJB1 Products)

Background: This gene encodes for a Connexin 32 protein. A large Charcot-Marie-Tooth disease family has been identified with a novel mutation in the Cx32 P2 promoter region at position -526bp. Cx32 mutants that are associated with a CNS phenotype may have toxic effects in oligodendrocytes.

Molecular Weight: 31 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization