Annexin IV antibody (N-Term)
-
- Target See all Annexin IV (ANXA4) Antibodies
- Annexin IV (ANXA4) (Annexin A4 (ANXA4))
-
Binding Specificity
- N-Term
-
Reactivity
- Chemical
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Annexin IV antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- Annexin A4 antibody was raised against the N terminal of ANXA4
- Cross-Reactivity
- Human, Rat (Rattus), Dog (Canine)
- Purification
- Purified
- Immunogen
- Annexin A4 antibody was raised using the N terminal of ANXA4 corresponding to a region with amino acids GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ
- Top Product
- Discover our top product ANXA4 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Annexin A4 Blocking Peptide, catalog no. 33R-3396, is also available for use as a blocking control in assays to test for specificity of this Annexin A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Annexin IV (ANXA4) (Annexin A4 (ANXA4))
- Alternative Name
- Annexin A4 (ANXA4 Products)
- Target Type
- Chemical
- Background
- Annexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANXA4 has 45 to 59 % identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANXA4 is almost exclusively expressed in epithelial cells.
- Molecular Weight
- 35 kDa (MW of target protein)
-