IGSF1 antibody (N-Term)

Catalog No. ABIN630244

Product Details anti-IGSF1 Antibody

Target: IGSF1 (INHBP) (Inhibin Binding Protein (INHBP))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IGSF1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: IGSF1 antibody was raised against the N terminal of IGSF1

Purification: Purified

Immunogen: IGSF1 antibody was raised using the N terminal of IGSF1 corresponding to a region with amino acids LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IGSF1 Blocking Peptide, catalog no. 33R-4821, is also available for use as a blocking control in assays to test for specificity of this IGSF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IGSF1

Target: IGSF1 (INHBP) (Inhibin Binding Protein (INHBP))

Alternative Name: IGSF1 (INHBP Products)

Synonyms: CHTE antibody, IGCD1 antibody, IGDC1 antibody, INHBP antibody, PGSF2 antibody, p120 antibody, 5330413N23 antibody, 5530402E03 antibody, AI747649 antibody, InhBP/p120 antibody, mKIAA0364 antibody, Inhbp antibody, immunoglobulin superfamily member 1 antibody, immunoglobulin superfamily, member 1 antibody, inhibin binding protein antibody, IGSF1 antibody, Igsf1 antibody, LOC443288 antibody

Background: Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.

Molecular Weight: 27 kDa (MW of target protein)