Annexin VII antibody (N-Term)
-
- Target See all Annexin VII (ANXA7) Antibodies
- Annexin VII (ANXA7) (Annexin A7 (ANXA7))
-
Binding Specificity
- N-Term
-
Reactivity
- Chemical
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Annexin VII antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Annexin A7 antibody was raised against the N terminal of ANXA7
- Cross-Reactivity
- Human
- Purification
- Purified
- Immunogen
- Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP
- Top Product
- Discover our top product ANXA7 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Annexin A7 Blocking Peptide, catalog no. 33R-6528, is also available for use as a blocking control in assays to test for specificity of this Annexin A7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Annexin VII (ANXA7) (Annexin A7 (ANXA7))
- Alternative Name
- Annexin A7 (ANXA7 Products)
- Target Type
- Chemical
- Background
- ANXA7 is a member of the annexin family of calcium-dependent phospholipid binding proteins. The Annexin VII gene contains 14 exons and spans approximately 34 kb of DNA. An alternatively spliced cassette exon results in two mRNA transcripts of 2.0 and 2.4 kb which are predicted to generate two protein isoforms differing in their N-terminal domain. The alternative splicing event is tissue specific and the mRNA containing the cassette exon is prevalent in brain, heart and skeletal muscle.
- Molecular Weight
- 51 kDa (MW of target protein)
-