MGST2 antibody (N-Term)
-
- Target See all MGST2 Antibodies
- MGST2 (Microsomal Glutathione S-Transferase 2 (MGST2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MGST2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- MGST2 antibody was raised against the N terminal of MGST2
- Purification
- Purified
- Immunogen
- MGST2 antibody was raised using the N terminal of MGST2 corresponding to a region with amino acids MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVF
- Top Product
- Discover our top product MGST2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MGST2 Blocking Peptide, catalog no. 33R-5664, is also available for use as a blocking control in assays to test for specificity of this MGST2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGST2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MGST2 (Microsomal Glutathione S-Transferase 2 (MGST2))
- Alternative Name
- MGST2 (MGST2 Products)
- Background
- The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. MGST2 is a protein which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4.
- Molecular Weight
- 16 kDa (MW of target protein)
-