MGST2 antibody (N-Term)

Catalog No. ABIN630237

Product Details anti-MGST2 Antibody

Target: MGST2 (Microsomal Glutathione S-Transferase 2 (MGST2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MGST2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: MGST2 antibody was raised against the N terminal of MGST2

Purification: Purified

Immunogen: MGST2 antibody was raised using the N terminal of MGST2 corresponding to a region with amino acids MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVF

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGST2 Blocking Peptide, catalog no. 33R-5664, is also available for use as a blocking control in assays to test for specificity of this MGST2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGST2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MGST2

Target: MGST2 (Microsomal Glutathione S-Transferase 2 (MGST2))

Alternative Name: MGST2 (MGST2 Products)

Synonyms: GST2 antibody, MGST-II antibody, microsomal glutathione S-transferase 2 antibody, AM1_4050 antibody, MGST2 antibody, Mgst2 antibody

Background: The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. MGST2 is a protein which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4.

Molecular Weight: 16 kDa (MW of target protein)