BDKRB2 antibody (N-Term)
-
- Target See all BDKRB2 Antibodies
- BDKRB2 (Bradykinin Receptor B2 (BDKRB2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BDKRB2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Bradykinin Receptor B2 antibody was raised against the N terminal of BDKRB2
- Purification
- Purified
- Immunogen
- Bradykinin Receptor B2 antibody was raised using the N terminal of BDKRB2 corresponding to a region with amino acids MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV
- Top Product
- Discover our top product BDKRB2 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Bradykinin Receptor B2 Blocking Peptide, catalog no. 33R-6004, is also available for use as a blocking control in assays to test for specificity of this Bradykinin Receptor B2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BDKRB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BDKRB2 (Bradykinin Receptor B2 (BDKRB2))
- Alternative Name
- Bradykinin Receptor B2 (BDKRB2 Products)
- Synonyms
- BDKRB2 antibody, b2r antibody, bk2 antibody, bk-2 antibody, bkr2 antibody, brb2 antibody, kinrec antibody, B2R antibody, BK-2 antibody, BK2 antibody, BKR2 antibody, BRB2 antibody, B2BKR antibody, B2BRA antibody, B(2) antibody, B2 antibody, BK2R antibody, Bdkrb2 antibody, bradykinin receptor B2 antibody, bradykinin receptor, beta 2 antibody, bradykinin type 2 receptor antibody, Bdkrb2 antibody, BDKRB2 antibody, bdkrb2 antibody, kinrec antibody, B2R antibody
- Background
- BDKRB2 is a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system.
- Molecular Weight
- 43 kDa (MW of target protein)
- Pathways
- ACE Inhibitor Pathway, Negative Regulation of intrinsic apoptotic Signaling
-