Complement C2 antibody (Middle Region)
-
- Target See all Complement C2 Antibodies
- Complement C2
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Complement C2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Complement C2 antibody was raised against the middle region of C2
- Purification
- Purified
- Immunogen
- Complement C2 antibody was raised using the middle region of C2 corresponding to a region with amino acids INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ
- Top Product
- Discover our top product Complement C2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Complement C2 Blocking Peptide, catalog no. 33R-4079, is also available for use as a blocking control in assays to test for specificity of this Complement C2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Complement C2
- Abstract
- Complement C2 Products
- Background
- Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.
- Molecular Weight
- 83 kDa (MW of target protein)
-