GEM antibody (C-Term)
-
- Target See all GEM Antibodies
- GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GEM antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- GEM antibody was raised against the C terminal of GEM
- Purification
- Purified
- Immunogen
- GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL
- Top Product
- Discover our top product GEM Primary Antibody
-
anti-GTP Binding Protein Overexpressed in Skeletal Muscle (GEM) (AA 219-270) antibody
GEM Reactivity: Human, Mouse, Rat, Dog, Cow, Guinea Pig, Horse, Rabbit, Monkey, Hamster, Pig, Bat, Xenopus laevis WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-GTP Binding Protein Overexpressed in Skeletal Muscle (GEM) (C-Term) antibodyGEM Reactivity: Human, Mouse, Rat, Dog, Cow, Guinea Pig, Horse, Rabbit WB, IHC Host: Rabbit Polyclonal unconjugated
anti-GTP Binding Protein Overexpressed in Skeletal Muscle (GEM) (AA 1-150) antibodyGEM Reactivity: Human ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-GTP Binding Protein Overexpressed in Skeletal Muscle (GEM) (N-Term) antibodyGEM Reactivity: Human, Mouse WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-GTP Binding Protein Overexpressed in Skeletal Muscle (GEM) (AA 34-46) antibodyVerified GEM Reactivity: Human WB, ELISA Host: Goat Polyclonal unconjugated
anti-GTP Binding Protein Overexpressed in Skeletal Muscle (GEM) (AA 1-100) antibodyGEM Reactivity: Human WB, ELISA Host: Mouse Monoclonal 4B12 unconjugated
anti-GTP Binding Protein Overexpressed in Skeletal Muscle (GEM) (N-Term) antibodyGEM Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-GTP Binding Protein Overexpressed in Skeletal Muscle (GEM) (AA 1-296) antibodyGEM Reactivity: Human WB Host: Mouse Polyclonal unconjugated
anti-GTP Binding Protein Overexpressed in Skeletal Muscle (GEM) (AA 35-84) antibodyGEM Reactivity: Human, Mouse, Dog, Cow, Guinea Pig, Horse, Rabbit, Monkey, Hamster, Pig WB Host: Rabbit Polyclonal unconjugated
anti-GTP Binding Protein Overexpressed in Skeletal Muscle (GEM) (AA 1-150) antibodyGEM Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GEM Blocking Peptide, catalog no. 33R-3073, is also available for use as a blocking control in assays to test for specificity of this GEM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GEM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))
- Alternative Name
- GEM (GEM Products)
- Synonyms
- KIR antibody, GEM antibody, DKFZp470D0612 antibody, LOC100221129 antibody, kir antibody, xgem antibody, zgc:153003 antibody, Gem antibody, AV020497 antibody, GTP binding protein overexpressed in skeletal muscle antibody, geminin, DNA replication inhibitor antibody, GTP binding protein (gene overexpressed in skeletal muscle) antibody, GEM antibody, gem antibody, Gem antibody, GMNN antibody
- Background
- GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.
- Molecular Weight
- 33 kDa (MW of target protein)
-
