NSMCE1 antibody
-
- Target See all NSMCE1 Antibodies
- NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NSMCE1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- NSMCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL
- Top Product
- Discover our top product NSMCE1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NSMCE1 Blocking Peptide, catalog no. 33R-8094, is also available for use as a blocking control in assays to test for specificity of this NSMCE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSMCE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))
- Alternative Name
- NSMCE1 (NSMCE1 Products)
- Synonyms
- zgc:92777 antibody, NSMCE1 antibody, NSE1 antibody, 2510027N19Rik antibody, RGD1307760 antibody, NSE1 homolog, SMC5-SMC6 complex component antibody, NSE1 homolog, SMC5-SMC6 complex component L homeolog antibody, nsmce1 antibody, NSMCE1 antibody, nsmce1.L antibody, Nsmce1 antibody
- Background
- NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Positive Regulation of Response to DNA Damage Stimulus
-