GNB1L antibody

Catalog No. ABIN630215

Product Details anti-GNB1L Antibody

Target: GNB1L (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNB1L antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: GNB1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids RVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GNB1L Blocking Peptide, catalog no. 33R-8245, is also available for use as a blocking control in assays to test for specificity of this GNB1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNB0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GNB1L

Target: GNB1L (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1-Like (GNB1L))

Alternative Name: GNB1L (GNB1L Products)

Synonyms: DGCRK3 antibody, GY2 antibody, WDR14 antibody, WDVCF antibody, ESTM55 antibody, Gm16314 antibody, Me49f07 antibody, OTTMUSG00000033458 antibody, Wdr14 antibody, Wdvcf antibody, GNB1L antibody, zgc:110763 antibody, G protein subunit beta 1 like antibody, guanine nucleotide binding protein (G protein), beta polypeptide 1-like antibody, GNB1L antibody, Gnb1l antibody, gnb1l antibody

Background: GNB1L is a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. Therefore, this gene may contribute to the etiology of those disorders.

Molecular Weight: 36 kDa (MW of target protein)