PIK3CB antibody (C-Term)

Catalog No. ABIN630206

Product Details anti-PIK3CB Antibody

Target: PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIK3CB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PIK3 CB antibody was raised against the C terminal of PIK3 B

Purification: Purified

Immunogen: PIK3 CB antibody was raised using the C terminal of PIK3 B corresponding to a region with amino acids VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIK3CB Blocking Peptide, catalog no. 33R-9615, is also available for use as a blocking control in assays to test for specificity of this PIK3CB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 B antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIK3CB

Target: PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))

Alternative Name: PIK3CB (PIK3CB Products)

Synonyms: P110BETA antibody, PI3K antibody, PI3KBETA antibody, PIK3C1 antibody, fb92a07 antibody, wu:fb92a07 antibody, 1110001J02Rik antibody, AI447572 antibody, p110beta antibody, PI3Kbeta antibody, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta antibody, phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta antibody, PIK3CB antibody, pik3cb antibody, Pik3cb antibody

Background: Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110 kDa catalytic subunit, such as PIK3CB, and an 85 kDa adaptor subunit.

Molecular Weight: 123 kDa (MW of target protein)