PIK3CB antibody (C-Term)
-
- Target See all PIK3CB Antibodies
- PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PIK3CB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PIK3 CB antibody was raised against the C terminal of PIK3 B
- Purification
- Purified
- Immunogen
- PIK3 CB antibody was raised using the C terminal of PIK3 B corresponding to a region with amino acids VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD
- Top Product
- Discover our top product PIK3CB Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PIK3CB Blocking Peptide, catalog no. 33R-9615, is also available for use as a blocking control in assays to test for specificity of this PIK3CB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 B antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIK3CB (Phosphoinositide-3-Kinase, Catalytic, beta Polypeptide (PIK3CB))
- Alternative Name
- PIK3CB (PIK3CB Products)
- Background
- Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110 kDa catalytic subunit, such as PIK3CB, and an 85 kDa adaptor subunit.
- Molecular Weight
- 123 kDa (MW of target protein)
-