HDAC9 antibody (C-Term)
-
- Target See all HDAC9 Antibodies
- HDAC9 (Histone Deacetylase 9 (HDAC9))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HDAC9 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- HDAC9 antibody was raised against the C terminal of HDAC9
- Purification
- Purified
- Immunogen
- HDAC9 antibody was raised using the C terminal of HDAC9 corresponding to a region with amino acids QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQVIGKDLAPGFVIKVII
- Top Product
- Discover our top product HDAC9 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HDAC9 Blocking Peptide, catalog no. 33R-7773, is also available for use as a blocking control in assays to test for specificity of this HDAC9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDAC9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HDAC9 (Histone Deacetylase 9 (HDAC9))
- Alternative Name
- HDAC9 (HDAC9 Products)
- Synonyms
- HD7 antibody, HD7b antibody, HD9 antibody, HDAC antibody, HDAC7 antibody, HDAC7B antibody, HDAC9B antibody, HDAC9FL antibody, HDRP antibody, MITR antibody, AV022454 antibody, D030072B18Rik antibody, HD7B antibody, Hdac7b antibody, Mitr antibody, mKIAA0744 antibody, hdac9 antibody, zgc:73392 antibody, TWIST antibody, HDAC9 antibody, DKFZp459E171 antibody, HDA09 antibody, HISTONE DEACETYLASE antibody, histone deacetylase 9 antibody, RGD1310748 antibody, RGD1563092 antibody, hdac9-A antibody, histone deacetylase 9 antibody, histone deacetylase 9b antibody, histone deacetylase 9 S homeolog antibody, HDAC9 antibody, Hdac9 antibody, hdac9b antibody, HDA9 antibody, hdac9.S antibody
- Background
- Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. HDAC9 has sequence homology to members of the histone deacetylase family. The MITR protein lacks the histone deacetylase catalytic domain. It represses MEF2 activity through recruitment of multicomponent corepressor complexes that include CtBP and HDACs. HDAC9 may play a role in hematopoiesis.
- Molecular Weight
- 65 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development
-