KIFC2 antibody (N-Term)
-
- Target See all KIFC2 Antibodies
- KIFC2 (Kinesin Family Member C2 (KIFC2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIFC2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- KIFC2 antibody was raised against the N terminal of KIFC2
- Purification
- Purified
- Immunogen
- KIFC2 antibody was raised using the N terminal of KIFC2 corresponding to a region with amino acids VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE
- Top Product
- Discover our top product KIFC2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIFC2 Blocking Peptide, catalog no. 33R-9783, is also available for use as a blocking control in assays to test for specificity of this KIFC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIFC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIFC2 (Kinesin Family Member C2 (KIFC2))
- Alternative Name
- KIFC2 (KIFC2 Products)
- Synonyms
- kinesin family member C2 antibody, Kifc2 antibody, KIFC2 antibody
- Background
- Members of the kinesin superfamily of microtubule-associated proteins are involved in a variety of intracellular processes including cell division and organelle transport. KIFC2 encodes a 792 amino acid protein, which contains the conserved motor domain at the C-terminal end of the protein and is most similar to members of the KAR3 family involved in cell division.
- Molecular Weight
- 90 kDa (MW of target protein)
-