RNASEH2A antibody (Middle Region)

Catalog No. ABIN630199

Product Details anti-RNASEH2A Antibody

Target: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Binding Specificity: Middle Region

Reactivity: Human, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNASEH2A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RNASEH2 A antibody was raised against the middle region of RNASEH2

Purification: Purified

Immunogen: RNASEH2 A antibody was raised using the middle region of RNASEH2 corresponding to a region with amino acids AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNASEH2A Blocking Peptide, catalog no. 33R-1458, is also available for use as a blocking control in assays to test for specificity of this RNASEH2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNASEH2A

Target: RNASEH2A (Ribonuclease H2, Subunit A (RNASEH2A))

Alternative Name: RNASEH2A (RNASEH2A Products)

Synonyms: 2400006P09Rik antibody, RNASEHI antibody, RNHIA antibody, RNHL antibody, zgc:56307 antibody, AGS4 antibody, JUNB antibody, ribonuclease H2 subunit A antibody, ribonuclease H2, large subunit antibody, ribonuclease H2, subunit A antibody, ribonuclease H2 subunit A L homeolog antibody, rnaseh2a antibody, RNASEH2A antibody, Rnaseh2a antibody, rnaseh2a.L antibody

Background: Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.

Molecular Weight: 33 kDa (MW of target protein)