RBMS1 antibody (C-Term)

Catalog No. ABIN630197

Product Details anti-RBMS1 Antibody

Target: RBMS1 (RNA Binding Motif, Single Stranded Interacting Protein 1 (RBMS1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBMS1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RBMS1 antibody was raised against the C terminal of RBMS1

Purification: Purified

Immunogen: RBMS1 antibody was raised using the C terminal of RBMS1 corresponding to a region with amino acids TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBMS1 Blocking Peptide, catalog no. 33R-9396, is also available for use as a blocking control in assays to test for specificity of this RBMS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBMS1

Target: RBMS1 (RNA Binding Motif, Single Stranded Interacting Protein 1 (RBMS1))

Alternative Name: RBMS1 (RBMS1 Products)

Synonyms: C2orf12 antibody, HCC-4 antibody, MSSP antibody, MSSP-1 antibody, MSSP-2 antibody, MSSP-3 antibody, SCR2 antibody, YC1 antibody, 2600014B10Rik antibody, AI255215 antibody, RBMS1 antibody, fe16a10 antibody, wu:fe16a10 antibody, RNA binding motif single stranded interacting protein 1 antibody, RNA binding motif, single stranded interacting protein 1 antibody, RNA binding motif, single stranded interacting protein 1 S homeolog antibody, RNA binding motif, single stranded interacting protein 1a antibody, RBMS1 antibody, Rbms1 antibody, rbms1.S antibody, rbms1 antibody, rbms1a antibody

Background: RBMS1 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.

Molecular Weight: 44 kDa (MW of target protein)