LIG4 antibody (N-Term)
-
- Target See all LIG4 Antibodies
- LIG4 (Ligase IV, DNA, ATP-Dependent (LIG4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LIG4 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- LIG4 antibody was raised against the N terminal of LIG4
- Purification
- Purified
- Immunogen
- LIG4 antibody was raised using the N terminal of LIG4 corresponding to a region with amino acids DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ
- Top Product
- Discover our top product LIG4 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LIG4 Blocking Peptide, catalog no. 33R-1948, is also available for use as a blocking control in assays to test for specificity of this LIG4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIG4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LIG4 (Ligase IV, DNA, ATP-Dependent (LIG4))
- Alternative Name
- LIG4 (LIG4 Products)
- Background
- LIG4 encodes a DNA ligase that joins single-strand breaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. This protein is essential for V(D)J recombination and DNA double-strand break (DSB) repair through nonhomologous end joining (NHEJ). This protein forms a complex with the X-ray repair cross complementing protein 4 (XRCC4), and further interacts with the DNA-dependent protein kinase (DNA-PK). Both XRCC4 and DNA-PK are known to be required for NHEJ. The crystal structure of the complex formed by this protein and XRCC4 has been resolved. Defects in this gene are the cause of LIG4 syndrome.
- Molecular Weight
- 104 kDa (MW of target protein)
- Pathways
- DNA Damage Repair, Production of Molecular Mediator of Immune Response
-