PRIM1 antibody (N-Term)

Catalog No. ABIN630190

Product Details anti-PRIM1 Antibody

Target: PRIM1 (Primase, DNA, Polypeptide 1 (49kDa) (PRIM1))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRIM1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRIM1 antibody was raised against the N terminal of PRIM1

Purification: Purified

Immunogen: PRIM1 antibody was raised using the N terminal of PRIM1 corresponding to a region with amino acids SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRIM1 Blocking Peptide, catalog no. 33R-8737, is also available for use as a blocking control in assays to test for specificity of this PRIM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRIM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRIM1

Target: PRIM1 (Primase, DNA, Polypeptide 1 (49kDa) (PRIM1))

Alternative Name: PRIM1 (PRIM1 Products)

Synonyms: AI324982 antibody, p49 antibody, dnapol-alpha50 antibody, DNA primase, p49 subunit antibody, DNA primase subunit 1 antibody, DNA primase subunit 1 S homeolog antibody, Prim1 antibody, PRIM1 antibody, prim1.S antibody

Background: The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. PRIM1 is the small, 49 kDa primase subunit.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Telomere Maintenance, Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, SARS-CoV-2 Protein Interactome