KIF25 antibody (C-Term)
-
- Target See all KIF25 Antibodies
- KIF25 (Kinesin Family Member 25 (KIF25))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIF25 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- KIF25 antibody was raised against the C terminal of KIF25
- Purification
- Purified
- Immunogen
- KIF25 antibody was raised using the C terminal of KIF25 corresponding to a region with amino acids VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTL
- Top Product
- Discover our top product KIF25 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIF25 Blocking Peptide, catalog no. 33R-9657, is also available for use as a blocking control in assays to test for specificity of this KIF25 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF25 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF25 (Kinesin Family Member 25 (KIF25))
- Alternative Name
- KIF25 (KIF25 Products)
- Synonyms
- KNSL3 antibody, kinesin family member 25 antibody, KIF25 antibody
- Background
- The protein encoded by the KIF25 gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. However, the particular function of this gene product has not yet been determined. Two alternatively spliced transcript variants which encode products have been described. Other splice variants have been found that lack exon 2 and the initiation codon for translation.
- Molecular Weight
- 41 kDa (MW of target protein)
-