MCM4 antibody (Middle Region)

Catalog No. ABIN630173

Product Details anti-MCM4 Antibody

Target: MCM4 (Minichromosome Maintenance Deficient 4 (MCM4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MCM4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MCM4 antibody was raised against the middle region of MCM4

Purification: Purified

Immunogen: MCM4 antibody was raised using the middle region of MCM4 corresponding to a region with amino acids VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MCM4 Blocking Peptide, catalog no. 33R-9921, is also available for use as a blocking control in assays to test for specificity of this MCM4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MCM4

Target: MCM4 (Minichromosome Maintenance Deficient 4 (MCM4))

Alternative Name: MCM4 (MCM4 Products)

Synonyms: cdc21 antibody, CDC21 antibody, CDC54 antibody, NKCD antibody, NKGCD antibody, P1-CDC21 antibody, hCdc21 antibody, 19G antibody, AI325074 antibody, AU045576 antibody, Cdc21 antibody, Mcmd4 antibody, mKIAA4003 antibody, mcdc21 antibody, cb1025 antibody, fc12c09 antibody, fj85g09 antibody, hm:zeh1616 antibody, wu:fc12c09 antibody, wu:fj85g09 antibody, zeh1616 antibody, minichromosome maintenance complex component 4 L homeolog antibody, minichromosome maintenance complex component 4 S homeolog antibody, minichromosome maintenance complex component 4 antibody, mcm4.L antibody, mcm4.S antibody, MCM4 antibody, mcm4 antibody, Mcm4 antibody

Background: The protein encoded by MCM4 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. The MCM4 gene is mapped to a region on the chromosome 8 head-to-head next to the PRkDaC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks.

Molecular Weight: 95 kDa (MW of target protein)

Pathways: DNA Damage Repair, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA