GZMH antibody
-
- Target See all GZMH Antibodies
- GZMH (Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GZMH antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- Granzyme H antibody was raised using a synthetic peptide corresponding to a region with amino acids MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG
- Top Product
- Discover our top product GZMH Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Granzyme H Blocking Peptide, catalog no. 33R-6337, is also available for use as a blocking control in assays to test for specificity of this Granzyme H antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GZMH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GZMH (Granzyme H (Cathepsin G-Like 2, Protein H-CCPX) (GZMH))
- Alternative Name
- Granzyme H (GZMH Products)
- Synonyms
- GZMH antibody, CCP-X antibody, CGL-2 antibody, CSP-C antibody, CTLA1 antibody, CTSGL2 antibody, granzyme H antibody, LOC617313 antibody, GZMH antibody
- Background
- This enzyme is probably necessary for target cell lysis in cell-mediated immune responses.
- Molecular Weight
- 27 kDa (MW of target protein)
-