RSAD2 antibody (N-Term)
-
- Target See all RSAD2 Antibodies
- RSAD2 (Radical S-Adenosyl Methionine Domain Containing 2 (RSAD2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RSAD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RSAD2 antibody was raised against the N terminal of RSAD2
- Purification
- Purified
- Immunogen
- RSAD2 antibody was raised using the N terminal of RSAD2 corresponding to a region with amino acids PLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLP
- Top Product
- Discover our top product RSAD2 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RSAD2 Blocking Peptide, catalog no. 33R-7188, is also available for use as a blocking control in assays to test for specificity of this RSAD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSAD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RSAD2 (Radical S-Adenosyl Methionine Domain Containing 2 (RSAD2))
- Alternative Name
- RSAD2 (RSAD2 Products)
- Synonyms
- CIG6 antibody, RSAD2 antibody, 2510004L01Rik antibody, cig33 antibody, cig5 antibody, vig1 antibody, Vig1 antibody, Best5 antibody, si:ch211-276e8.2 antibody, zgc:112342 antibody, viperin antibody, rsad2 antibody, radical S-adenosyl methionine domain containing 2 antibody, viperin antibody, RSAD2 antibody, Rsad2 antibody, rsad2 antibody, vig1 antibody
- Background
- RSAD2 is a potential antiviral effector.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response
-