Asporin antibody (Middle Region)
-
- Target See all Asporin (ASPN) Antibodies
- Asporin (ASPN)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Asporin antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- Asporin antibody was raised against the middle region of ASPN
- Purification
- Purified
- Immunogen
- Asporin antibody was raised using the middle region of ASPN corresponding to a region with amino acids NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK
- Top Product
- Discover our top product ASPN Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Asporin Blocking Peptide, catalog no. 33R-6743, is also available for use as a blocking control in assays to test for specificity of this Asporin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASPN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Asporin (ASPN)
- Alternative Name
- Asporin (ASPN Products)
- Background
- ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin.
- Molecular Weight
- 42 kDa (MW of target protein)
-