SEMG1 antibody (N-Term)

Catalog No. ABIN630160

Product Details anti-SEMG1 Antibody

Target: SEMG1 (Semenogelin I (SEMG1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SEMG1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Semenogelin I antibody was raised against the N terminal of SEMG1

Purification: Purified

Immunogen: Semenogelin I antibody was raised using the N terminal of SEMG1 corresponding to a region with amino acids QKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHL

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Semenogelin I Blocking Peptide, catalog no. 33R-7601, is also available for use as a blocking control in assays to test for specificity of this Semenogelin I antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SEMG1

Target: SEMG1 (Semenogelin I (SEMG1))

Alternative Name: Semenogelin I (SEMG1 Products)

Background: SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides, with each possibly having a separate function. The proteolysis process breaks down the gel matrix and allows the spermatozoa to move more freely.

Molecular Weight: 51 kDa (MW of target protein)