PSG1 antibody (N-Term)

Catalog No. ABIN630159

Product Details anti-PSG1 Antibody

Target: PSG1 (Pregnancy Specific beta-1-Glycoprotein 1 (PSG1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSG1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PSG1 antibody was raised against the N terminal of PSG1

Purification: Purified

Immunogen: PSG1 antibody was raised using the N terminal of PSG1 corresponding to a region with amino acids SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSG1 Blocking Peptide, catalog no. 33R-8483, is also available for use as a blocking control in assays to test for specificity of this PSG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSG1

Target: PSG1 (Pregnancy Specific beta-1-Glycoprotein 1 (PSG1))

Alternative Name: PSG1 (PSG1 Products)

Synonyms: B1G1 antibody, CD66f antibody, DHFRP2 antibody, FL-NCA-1/2 antibody, PBG1 antibody, PS-beta-C/D antibody, PS-beta-G-1 antibody, PSBG-1 antibody, PSBG1 antibody, PSG95 antibody, PSGGA antibody, PSGIIA antibody, SP1 antibody, PSG1 antibody, PSG10 antibody, PSG12 antibody, Psg antibody, pregnancy specific beta-1-glycoprotein 1 antibody, pregnancy specific beta-1-glycoprotein 2 antibody, pregnancy specific beta-1-glycoprotein 10, pseudogene antibody, pregnancy-specific beta 1-glycoprotein antibody, PSG1 antibody, PSG2 antibody, PSG10P antibody, Psgb1 antibody

Background: PSG1 plays an immunomodulatory roles during pregnancy.

Molecular Weight: 47 kDa (MW of target protein)