PLAP antibody
-
- Target See all PLAP (ALPP) Antibodies
- PLAP (ALPP) (Placental Alkaline Phosphatase (ALPP))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PLAP antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- ALPP antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA
- Top Product
- Discover our top product ALPP Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALPP Blocking Peptide, catalog no. 33R-9362, is also available for use as a blocking control in assays to test for specificity of this ALPP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALPP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLAP (ALPP) (Placental Alkaline Phosphatase (ALPP))
- Alternative Name
- ALPP (ALPP Products)
- Synonyms
- ECK0378 antibody, JW0374 antibody, psiA antibody, ALP antibody, PALP antibody, PLAP antibody, PLAP-1 antibody, ILC antibody, CTACK antibody, ESkine antibody, Akp2 antibody, alp antibody, zgc:56672 antibody, DDBDRAFT_0205491 antibody, DDBDRAFT_0231570 antibody, DDB_0205491 antibody, DDB_0231570 antibody, ALPI antibody, Actn2lp antibody, Alp antibody, bacterial alkaline phosphatase antibody, alkaline phosphatase, placental antibody, alkaline phosphatase, placental type antibody, C-C motif chemokine ligand 27 antibody, alkaline phosphatase, liver/bone/kidney antibody, alkaline phosphatase antibody, alkaline phosphatase, intestinal antibody, PDZ and LIM domain 3 antibody, phoA antibody, ALPP antibody, LOC100436725 antibody, CCL27 antibody, alpl antibody, alp antibody, ALPI antibody, Pdlim3 antibody, Alpp antibody
- Background
- There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. ALPP is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form.
- Molecular Weight
- 59 kDa (MW of target protein)
-