SDF2 antibody (N-Term)

Catalog No. ABIN630142

Product Details anti-SDF2 Antibody

Target: SDF2 (Stromal Cell Derived Factor 2 (SDF2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SDF2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SDF2 antibody was raised against the N terminal of SDF2

Purification: Purified

Immunogen: SDF2 antibody was raised using the N terminal of SDF2 corresponding to a region with amino acids KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SDF2 Blocking Peptide, catalog no. 33R-4518, is also available for use as a blocking control in assays to test for specificity of this SDF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SDF2

Target: SDF2 (Stromal Cell Derived Factor 2 (SDF2))

Alternative Name: SDF2 (SDF2 Products)

Synonyms: AI853825 antibody, fk23f01 antibody, wu:fk23f01 antibody, zgc:66291 antibody, stromal cell derived factor 2 antibody, stromal cell-derived factor 2 antibody, stromal cell derived factor 2 L homeolog antibody, sdf2 antibody, Sdf2 antibody, sdf2.L antibody, SDF2 antibody

Background: SDF2 is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome