LNX1 antibody (C-Term)

Catalog No. ABIN630139

Product Details anti-LNX1 Antibody

Target: LNX1 (Ligand of Numb-Protein X 1 (LNX1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LNX1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LNX1 antibody was raised against the C terminal of LNX1

Purification: Purified

Immunogen: LNX1 antibody was raised using the C terminal of LNX1 corresponding to a region with amino acids SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LNX1 Blocking Peptide, catalog no. 33R-8514, is also available for use as a blocking control in assays to test for specificity of this LNX1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LNX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LNX1

Target: LNX1 (Ligand of Numb-Protein X 1 (LNX1))

Alternative Name: LNX1 (LNX1 Products)

Synonyms: LNX1 antibody, fj78f06 antibody, lnx antibody, si:dkey-12h2.1 antibody, wu:fj78f06 antibody, zgc:152906 antibody, Lnx antibody, LNX antibody, MPDZ antibody, PDZRN2 antibody, ligand of numb-protein X 1 antibody, LNX1 antibody, lnx1 antibody, Lnx1 antibody

Background: LNX1 is a membrane-bound protein that is involved in signal transduction and protein interactions. LNX1 is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis.

Molecular Weight: 70 kDa (MW of target protein)