NAGS antibody (C-Term)
-
- Target See all NAGS Antibodies
- NAGS (N-Acetylglutamate Synthase (NAGS))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NAGS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NAGS antibody was raised against the C terminal of NAGS
- Purification
- Purified
- Immunogen
- NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD
- Top Product
- Discover our top product NAGS Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NAGS Blocking Peptide, catalog no. 33R-10162, is also available for use as a blocking control in assays to test for specificity of this NAGS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAGS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NAGS (N-Acetylglutamate Synthase (NAGS))
- Alternative Name
- NAGS (NAGS Products)
- Background
- NAGS is a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAG is a cofactor of carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle in mammals. Deficiencies in N-acetylglutamate synthase have been associated with hyperammonemia.
- Molecular Weight
- 58 kDa (MW of target protein)
-