PCMT1 antibody
-
- Target See all PCMT1 Antibodies
- PCMT1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PCMT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- PCMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids APYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQD
- Top Product
- Discover our top product PCMT1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PCMT1 Blocking Peptide, catalog no. 33R-1442, is also available for use as a blocking control in assays to test for specificity of this PCMT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCMT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCMT1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1))
- Alternative Name
- PCMT1 (PCMT1 Products)
- Synonyms
- PIMT antibody, C79501 antibody, PCM antibody, PCMT antibody, etID309741.20 antibody, fj13d06 antibody, pimt antibody, wu:fj13d06 antibody, protein-L-isoaspartate (D-aspartate) O-methyltransferase antibody, protein-L-isoaspartate (D-aspartate) O-methyltransferase 1 antibody, protein-L-isoaspartate (D-aspartate) O-methyltransferase L homeolog antibody, protein-L-isoaspartate(D-aspartate)O-methyltransferase antibody, PCMT1 antibody, Pcmt1 antibody, pcmt1.L antibody, pcmt1 antibody, pcmt antibody
- Background
- Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type II enzyme catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the free carboxyl groups of D-aspartyl and L-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal L-aspartyl and L-asparaginyl residues and represent sites of covalent damage to aging proteins PCMT1 (EC 2.1.1.77) is a protein repair enzyme that initiates the conversion of abnormal D-aspartyl and L-isoaspartyl residues to the normal L-aspartyl form.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-