DNASE2B antibody (C-Term)
-
- Target See all DNASE2B Antibodies
- DNASE2B (Deoxyribonuclease II beta (DNASE2B))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DNASE2B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DNASE2 B antibody was raised against the C terminal of DNASE2
- Purification
- Purified
- Immunogen
- DNASE2 B antibody was raised using the C terminal of DNASE2 corresponding to a region with amino acids MAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQD
- Top Product
- Discover our top product DNASE2B Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DNASE2B Blocking Peptide, catalog no. 33R-5727, is also available for use as a blocking control in assays to test for specificity of this DNASE2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNASE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNASE2B (Deoxyribonuclease II beta (DNASE2B))
- Alternative Name
- DNASE2B (DNASE2B Products)
- Background
- DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs.
- Molecular Weight
- 17 kDa (MW of target protein)
-