FGA antibody (N-Term)
-
- Target See all FGA Antibodies
- FGA (Fibrinogen alpha Chain (FGA))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FGA antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- Fibrinogen Alpha antibody was raised against the N terminal of FGA
- Purification
- Purified
- Immunogen
- Fibrinogen Alpha antibody was raised using the N terminal of FGA corresponding to a region with amino acids MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS
- Top Product
- Discover our top product FGA Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Fibrinogen Alpha Blocking Peptide, catalog no. 33R-6003, is also available for use as a blocking control in assays to test for specificity of this Fibrinogen Alpha antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
An efficient system for secretory production of fibrinogen using a hepatocellular carcinoma cell line." in: Hepatology research : the official journal of the Japan Society of Hepatology, Vol. 45, Issue 3, pp. 315-25, (2016) (PubMed).
: "
-
An efficient system for secretory production of fibrinogen using a hepatocellular carcinoma cell line." in: Hepatology research : the official journal of the Japan Society of Hepatology, Vol. 45, Issue 3, pp. 315-25, (2016) (PubMed).
-
- Target
- FGA (Fibrinogen alpha Chain (FGA))
- Alternative Name
- Fibrinogen alpha (FGA Products)
- Synonyms
- Fib2 antibody, ENSMUSG00000059807 antibody, Fib antibody, Ac1873 antibody, Fba5e antibody, fibrinogen alpha chain antibody, FGA antibody, Fga antibody, LOC698244 antibody
- Background
- FGA is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis.
- Molecular Weight
- 71 kDa (MW of target protein)
-