GABRG2 antibody

Catalog No. ABIN630118

Product Details anti-GABRG2 Antibody

Target: GABRG2 (gamma-aminobutyric Acid (GABA) A Receptor, gamma 2 (GABRG2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GABRG2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: GABRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GABRG2 Blocking Peptide, catalog no. 33R-1384, is also available for use as a blocking control in assays to test for specificity of this GABRG2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GABRG2

Target: GABRG2 (gamma-aminobutyric Acid (GABA) A Receptor, gamma 2 (GABRG2))

Alternative Name: GABRG2 (GABRG2 Products)

Synonyms: cae2 antibody, eca2 antibody, gabrg1 antibody, gefsp3 antibody, si:ch211-145n14.1 antibody, CAE2 antibody, ECA2 antibody, GEFSP3 antibody, GABAA-R antibody, Gabrg-2 antibody, gamma2 antibody, gamma-aminobutyric acid type A receptor gamma2 subunit antibody, gamma-aminobutyric acid (GABA) A receptor, gamma 2 antibody, gamma-aminobutyric acid type A receptor gamma 2 subunit antibody, gamma-aminobutyric acid (GABA) A receptor, subunit gamma 2 antibody, GABRG2 antibody, gabrg2 antibody, Gabrg2 antibody

Background: Gamma-aminobutyric acid (GABA), the major inhibitory neurotransmitter in the brain, mediates neuronal inhibition by binding to GABA receptors. The type A GABA receptors are pentameric chloride channels assembled from among many genetic variants of GABA(A) subunits. GABRG2 is the gamma 2 subunit of GABA(A) receptor. Mutations in this gene have been associated with epilepsy and febrile seizures.

Molecular Weight: 36 kDa (MW of target protein)