CHRNB2 antibody
-
- Target See all CHRNB2 Antibodies
- CHRNB2 (Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHRNB2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- CHRNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWD
- Top Product
- Discover our top product CHRNB2 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHRNB2 Blocking Peptide, catalog no. 33R-1722, is also available for use as a blocking control in assays to test for specificity of this CHRNB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHRNB2 (Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2))
- Alternative Name
- CHRNB2 (CHRNB2 Products)
- Synonyms
- EFNL3 antibody, nAChRB2 antibody, NACHRB2 antibody, Acrb-2 antibody, Acrb2 antibody, C030030P04Rik antibody, [b]2-nAchR antibody, cholinergic receptor nicotinic beta 2 subunit antibody, cholinergic receptor nicotinic beta 2 subunit S homeolog antibody, cholinergic receptor, nicotinic, beta polypeptide 2 (neuronal) antibody, CHRNB2 antibody, chrnb2.S antibody, Chrnb2 antibody
- Background
- Mutations in nAChRs are found in a rare form of nocturnal frontal lobe epilepsy . Previously, some nAChR mutations have been described that are associated with additional neurological features such as psychiatric disorders or cognitive defects. A new CHRNB2 mutation located in transmembrane region 3 (M3), outside the known ADNFLE mutation cluster. The CHRNB2 mutation I312M, which occurred de novo in twins, markedly increases the receptor's sensitivity to acetylcholine. Phenotypically, the mutation is associated not only with typical ADNFLE, but also with distinct deficits in memory. The cognitive problems are most obvious in tasks requiring the organization and storage of verbal information.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Feeding Behaviour
-