KCNK13 antibody (C-Term)

Catalog No. ABIN630111

Product Details anti-KCNK13 Antibody

Target: KCNK13 (Potassium Channel Subfamily K Member 13 (KCNK13))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNK13 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNK13 antibody was raised against the C terminal of KCNK13

Purification: Purified

Immunogen: KCNK13 antibody was raised using the C terminal of KCNK13 corresponding to a region with amino acids SMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIM

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNK13 Blocking Peptide, catalog no. 33R-8639, is also available for use as a blocking control in assays to test for specificity of this KCNK13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNK13

Target: KCNK13 (Potassium Channel Subfamily K Member 13 (KCNK13))

Alternative Name: KCNK13 (KCNK13 Products)

Synonyms: BB085247 antibody, F730021E22Rik antibody, Gm1570 antibody, Gm1685 antibody, K2p13.1 antibody, THIK-1 antibody, THIK1 antibody, prdx1 antibody, kcnk13 antibody, si:ch211-173b9.3 antibody, zgc:171694 antibody, potassium channel, subfamily K, member 13 antibody, potassium two pore domain channel subfamily K member 13 antibody, potassium channel subfamily K member 13 antibody, potassium channel, subfamily K, member 13b antibody, potassium channel, subfamily K, member 13a antibody, Kcnk13 antibody, KCNK13 antibody, Tsp_07890 antibody, kcnk13b antibody, kcnk13a antibody

Background: KCNK13 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of KCNK13 is an open channel that can be stimulated by arachidonic acid.

Molecular Weight: 45 kDa (MW of target protein)