KCNK13 antibody (C-Term)
-
- Target See all KCNK13 Antibodies
- KCNK13 (Potassium Channel Subfamily K Member 13 (KCNK13))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNK13 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNK13 antibody was raised against the C terminal of KCNK13
- Purification
- Purified
- Immunogen
- KCNK13 antibody was raised using the C terminal of KCNK13 corresponding to a region with amino acids SMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIM
- Top Product
- Discover our top product KCNK13 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNK13 Blocking Peptide, catalog no. 33R-8639, is also available for use as a blocking control in assays to test for specificity of this KCNK13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNK13 (Potassium Channel Subfamily K Member 13 (KCNK13))
- Alternative Name
- KCNK13 (KCNK13 Products)
- Background
- KCNK13 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of KCNK13 is an open channel that can be stimulated by arachidonic acid.
- Molecular Weight
- 45 kDa (MW of target protein)
-