KCNK10 antibody (N-Term)

Catalog No. ABIN630107

Product Details anti-KCNK10 Antibody

Target: KCNK10 (Potassium Channel, Subfamily K, Member 10 (KCNK10))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNK10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNK10 antibody was raised against the N terminal of KCNK10

Purification: Purified

Immunogen: KCNK10 antibody was raised using the N terminal of KCNK10 corresponding to a region with amino acids VVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVSP

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNK10 Blocking Peptide, catalog no. 33R-9866, is also available for use as a blocking control in assays to test for specificity of this KCNK10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNK10

Target: KCNK10 (Potassium Channel, Subfamily K, Member 10 (KCNK10))

Alternative Name: KCNK10 (KCNK10 Products)

Synonyms: KCNK10 antibody, K2p10.1 antibody, TREK-2 antibody, TREK2 antibody, 1700024D23Rik antibody, 3010005K24Rik antibody, Trek2 antibody, k2p10.1 antibody, trek-2 antibody, trek2 antibody, potassium two pore domain channel subfamily K member 10 antibody, potassium channel, subfamily K, member 10 antibody, potassium channel, two pore domain subfamily K, member 10 L homeolog antibody, KCNK10 antibody, Kcnk10 antibody, kcnk10.L antibody

Background: KCNK10 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is highly expressed in the kidney and pancreas. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. The protein is stimulated strongly by arachidonic acid and to a lesser degree by membrane stretching, intracellular acidification, and general anaesthetics. Three transcript variants have been identified for this gene.

Molecular Weight: 59 kDa (MW of target protein)