GABRA3 antibody

Catalog No. ABIN630101

Product Details anti-GABRA3 Antibody

Target: GABRA3 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 3 (GABRA3))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GABRA3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: GABRA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GABRA3 Blocking Peptide, catalog no. 33R-1156, is also available for use as a blocking control in assays to test for specificity of this GABRA3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GABRA3

Target: GABRA3 (gamma-aminobutyric Acid (GABA) A Receptor, alpha 3 (GABRA3))

Alternative Name: GABRA3 (GABRA3 Products)

Synonyms: GABRA3 antibody, Gabra-3 antibody, si:ch211-113k9.1 antibody, gamma-aminobutyric acid type A receptor alpha3 subunit antibody, gamma-aminobutyric acid (GABA) A receptor, alpha 3 antibody, gamma-aminobutyric acid (GABA) A receptor, subunit alpha 3 antibody, gamma-aminobutyric acid receptor subunit alpha-3 antibody, GABRA3 antibody, gabra3 antibody, Gabra3 antibody, LOC100653496 antibody

Background: GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.

Molecular Weight: 55 kDa (MW of target protein)