ASIC3 antibody (N-Term)

Catalog No. ABIN630092

Product Details anti-ASIC3 Antibody

Target: ASIC3 (ACCN3) (Amiloride-Sensitive Cation Channel 3 (ACCN3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASIC3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ACCN3 antibody was raised against the N terminal of ACCN3

Purification: Purified

Immunogen: ACCN3 antibody was raised using the N terminal of ACCN3 corresponding to a region with amino acids VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACCN3 Blocking Peptide, catalog no. 33R-9439, is also available for use as a blocking control in assays to test for specificity of this ACCN3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASIC3

Target: ASIC3 (ACCN3) (Amiloride-Sensitive Cation Channel 3 (ACCN3))

Alternative Name: ACCN3 (ACCN3 Products)

Synonyms: ACCN3 antibody, Accn3 antibody, DRASIC antibody, SLNAC1 antibody, TNaC1 antibody, AW742291 antibody, TNAC1 antibody, amiloride-sensitive cation channel 3 antibody, acid sensing ion channel subunit 3 antibody, acid-sensing (proton-gated) ion channel 3 antibody, ACCN3 antibody, ASIC3 antibody, Asic3 antibody

Background: ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing.

Molecular Weight: 58 kDa (MW of target protein)