ASIC3 antibody (N-Term)
-
- Target See all ASIC3 (ACCN3) Antibodies
- ASIC3 (ACCN3) (Amiloride-Sensitive Cation Channel 3 (ACCN3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ASIC3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ACCN3 antibody was raised against the N terminal of ACCN3
- Purification
- Purified
- Immunogen
- ACCN3 antibody was raised using the N terminal of ACCN3 corresponding to a region with amino acids VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL
- Top Product
- Discover our top product ACCN3 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACCN3 Blocking Peptide, catalog no. 33R-9439, is also available for use as a blocking control in assays to test for specificity of this ACCN3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASIC3 (ACCN3) (Amiloride-Sensitive Cation Channel 3 (ACCN3))
- Alternative Name
- ACCN3 (ACCN3 Products)
- Background
- ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing.
- Molecular Weight
- 58 kDa (MW of target protein)
-