CLIC5 antibody (Middle Region)

Catalog No. ABIN630088

Product Details anti-CLIC5 Antibody

Target: CLIC5 (Chloride Intracellular Channel 5 (CLIC5))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLIC5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: CLIC5 antibody was raised against the middle region of CLIC5

Purification: Purified

Immunogen: CLIC5 antibody was raised using the middle region of CLIC5 corresponding to a region with amino acids HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFS

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLIC5 Blocking Peptide, catalog no. 33R-3815, is also available for use as a blocking control in assays to test for specificity of this CLIC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLIC5

Target: CLIC5 (Chloride Intracellular Channel 5 (CLIC5))

Alternative Name: CLIC5 (CLIC5 Products)

Synonyms: MST130 antibody, MSTP130 antibody, 5730531E12Rik antibody, B330005L24 antibody, Gm322 antibody, jbg antibody, clic5 antibody, im:6907594 antibody, zgc:77538 antibody, CLIC5 antibody, zgc:101827 antibody, chloride intracellular channel 5 antibody, chloride intracellular channel 5b antibody, chloride intracellular channel 5a antibody, chloride intracellular channel 5 L homeolog antibody, CLIC5 antibody, Clic5 antibody, clic5b antibody, clic5a antibody, clic5.L antibody

Background: CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli. CLIon Channel-5A has a role as a chloride channel in vitro and binds to cortical actin cytoskeleton.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Sensory Perception of Sound