KCNH6 antibody
-
- Target See all KCNH6 Antibodies
- KCNH6 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 6 (KCNH6))
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNH6 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- KCNH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK
- Top Product
- Discover our top product KCNH6 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNH6 Blocking Peptide, catalog no. 33R-3382, is also available for use as a blocking control in assays to test for specificity of this KCNH6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNH6 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 6 (KCNH6))
- Alternative Name
- KCNH6 (KCNH6 Products)
- Synonyms
- KCNH2 antibody, erg antibody, ERG-2 antibody, ERG2 antibody, HERG2 antibody, Kv11.2 antibody, hERG-2 antibody, m-erg2 antibody, Erg2 antibody, potassium voltage-gated channel subfamily H member 6 antibody, potassium voltage-gated channel, subfamily H (eag-related), member 6 antibody, KCNH6 antibody, Kcnh6 antibody
- Background
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH6 encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.
- Molecular Weight
- 109 kDa (MW of target protein)
-