KCNRG antibody (N-Term)

Catalog No. ABIN630080

Product Details anti-KCNRG Antibody

Target: KCNRG (Potassium Channel Regulator (KCNRG))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNRG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNRG antibody was raised against the N terminal of KCNRG

Purification: Purified

Immunogen: KCNRG antibody was raised using the N terminal of KCNRG corresponding to a region with amino acids VDRDGDLFSFILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNP

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNRG Blocking Peptide, catalog no. 33R-9475, is also available for use as a blocking control in assays to test for specificity of this KCNRG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNRG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNRG

Target: KCNRG (Potassium Channel Regulator (KCNRG))

Alternative Name: KCNRG (KCNRG Products)

Synonyms: DLTET antibody, Clld4 antibody, E030012H22Rik antibody, Gm745 antibody, putative Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase antibody, potassium channel regulator antibody, LOC5569660 antibody, KCNRG antibody, Kcnrg antibody

Background: KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels and inhibits their function.

Molecular Weight: 31 kDa (MW of target protein)