KCTD18 antibody (N-Term)

Catalog No. ABIN630077

Product Details anti-KCTD18 Antibody

Target: KCTD18 (Potassium Channel Tetramerisation Domain Containing 18 (KCTD18))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD18 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCTD18 antibody was raised against the N terminal of KCTD18

Purification: Purified

Immunogen: KCTD18 antibody was raised using the N terminal of KCTD18 corresponding to a region with amino acids LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD18 Blocking Peptide, catalog no. 33R-5035, is also available for use as a blocking control in assays to test for specificity of this KCTD18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD18

Target: KCTD18 (Potassium Channel Tetramerisation Domain Containing 18 (KCTD18))

Alternative Name: KCTD18 (KCTD18 Products)

Synonyms: KCTD18 antibody, 4932411A20Rik antibody, 6530404F10Rik antibody, RGD1564820 antibody, potassium channel tetramerization domain containing 18 antibody, potassium channel tetramerization domain containing 18 L homeolog antibody, potassium channel tetramerisation domain containing 18 antibody, KCTD18 antibody, kctd18.L antibody, Kctd18 antibody

Background: The function of Anti-KCTD18 has not yet been determined.

Molecular Weight: 47 kDa (MW of target protein)