CLIC5 antibody (C-Term)
-
- Target See all CLIC5 Antibodies
- CLIC5 (Chloride Intracellular Channel 5 (CLIC5))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CLIC5 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- CLIC5 antibody was raised against the C terminal of CLIC5
- Purification
- Purified
- Immunogen
- CLIC5 antibody was raised using the C terminal of CLIC5 corresponding to a region with amino acids YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
- Top Product
- Discover our top product CLIC5 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CLIC5 Blocking Peptide, catalog no. 33R-10228, is also available for use as a blocking control in assays to test for specificity of this CLIC5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLIC5 (Chloride Intracellular Channel 5 (CLIC5))
- Alternative Name
- CLIC5 (CLIC5 Products)
- Background
- Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-