CATSPER2 antibody (C-Term)

Catalog No. ABIN630073

Product Details anti-CATSPER2 Antibody

Target: CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CATSPER2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CATSPER2 antibody was raised against the C terminal of CATSPER2

Purification: Purified

Immunogen: CATSPER2 antibody was raised using the C terminal of CATSPER2 corresponding to a region with amino acids LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDK

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CATSPER2 Blocking Peptide, catalog no. 33R-5202, is also available for use as a blocking control in assays to test for specificity of this CATSPER2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CATSPER2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CATSPER2

Target: CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))

Alternative Name: CATSPER2 (CATSPER2 Products)

Synonyms: CATSPER2 antibody, cation channel, sperm associated 2 antibody, cation channel sperm associated 2 antibody, CATSPER2 antibody, Catsper2 antibody

Background: Calcium ions play a primary role in the regulation of sperm motility. This gene belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. This gene is part of a tandem repeat on chromosome 15q14, the second copy of this gene is thought to be a pseudogene. Additional splice variants have been described but their full-length nature has not been determined.

Molecular Weight: 58 kDa (MW of target protein)