CATSPER2 antibody (C-Term)
-
- Target See all CATSPER2 Antibodies
- CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CATSPER2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CATSPER2 antibody was raised against the C terminal of CATSPER2
- Purification
- Purified
- Immunogen
- CATSPER2 antibody was raised using the C terminal of CATSPER2 corresponding to a region with amino acids LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDK
- Top Product
- Discover our top product CATSPER2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CATSPER2 Blocking Peptide, catalog no. 33R-5202, is also available for use as a blocking control in assays to test for specificity of this CATSPER2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CATSPER2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))
- Alternative Name
- CATSPER2 (CATSPER2 Products)
- Background
- Calcium ions play a primary role in the regulation of sperm motility. This gene belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. This gene is part of a tandem repeat on chromosome 15q14, the second copy of this gene is thought to be a pseudogene. Additional splice variants have been described but their full-length nature has not been determined.
- Molecular Weight
- 58 kDa (MW of target protein)
-