CLIC2 antibody (C-Term)

Catalog No. ABIN630069

Product Details anti-CLIC2 Antibody

Target: CLIC2 (Chloride Intracellular Channel 2 (CLIC2))

Binding Specificity: C-Term

Reactivity: Human, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLIC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CLIC2 antibody was raised against the C terminal of CLIC2

Purification: Purified

Immunogen: CLIC2 antibody was raised using the C terminal of CLIC2 corresponding to a region with amino acids SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLIC2 Blocking Peptide, catalog no. 33R-8293, is also available for use as a blocking control in assays to test for specificity of this CLIC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLIC2

Target: CLIC2 (Chloride Intracellular Channel 2 (CLIC2))

Alternative Name: CLIC2 (CLIC2 Products)

Synonyms: zgc:92762 antibody, CLIC2 antibody, CLIC2b antibody, MRXS32 antibody, XAP121 antibody, chloride intracellular channel 2 antibody, clic2 antibody, CLIC2 antibody, Clic2 antibody

Background: Chloride intracellular channel 2 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel 2 encodes a protein that is detected in fetal liver and adult skeletal muscle tissue. CLIon Channel2 maps to the candidate region on chromosome X for incontinentia pigmenti.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity