Bestrophin 4 antibody (N-Term)
-
- Target See all Bestrophin 4 (BEST4) Antibodies
- Bestrophin 4 (BEST4)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Bestrophin 4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- VMD2 L2 antibody was raised against the N terminal Of Vmd2 2
- Purification
- Purified
- Immunogen
- VMD2 L2 antibody was raised using the N terminal Of Vmd2 2 corresponding to a region with amino acids MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITY
- Top Product
- Discover our top product BEST4 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VMD2L2 Blocking Peptide, catalog no. 33R-6572, is also available for use as a blocking control in assays to test for specificity of this VMD2L2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VMD0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Bestrophin 4 (BEST4)
- Alternative Name
- VMD2L2 (BEST4 Products)
- Background
- VMD2L2 is 1 of 3 VMD2-like genes which encode transmembrane spanning proteins that share a homology region with a high content of aromatic residues including an invariant arginine (R), phenylalanine (F), and proline (P) motif.
- Molecular Weight
- 52 kDa (MW of target protein)
-