Bestrophin 4 antibody (N-Term)

Catalog No. ABIN630067

Product Details anti-Bestrophin 4 Antibody

Target: Bestrophin 4 (BEST4)

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Bestrophin 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: VMD2 L2 antibody was raised against the N terminal Of Vmd2 2

Purification: Purified

Immunogen: VMD2 L2 antibody was raised using the N terminal Of Vmd2 2 corresponding to a region with amino acids MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITY

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VMD2L2 Blocking Peptide, catalog no. 33R-6572, is also available for use as a blocking control in assays to test for specificity of this VMD2L2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VMD0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Bestrophin 4

Target: Bestrophin 4 (BEST4)

Alternative Name: VMD2L2 (BEST4 Products)

Synonyms: CG7259 antibody, CT22395 antibody, Dmel\\CG7259 antibody, dbest4 antibody, BEST4 antibody, VMD2L2 antibody, vmd2l2 antibody, Bestrophin 4 antibody, bestrophin 4 antibody, Best4 antibody, BEST4 antibody, best4 antibody

Background: VMD2L2 is 1 of 3 VMD2-like genes which encode transmembrane spanning proteins that share a homology region with a high content of aromatic residues including an invariant arginine (R), phenylalanine (F), and proline (P) motif.

Molecular Weight: 52 kDa (MW of target protein)