CLIC1 antibody (C-Term)
-
- Target See all CLIC1 Antibodies
- CLIC1 (Chloride Intracellular Channel 1 (CLIC1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CLIC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CLIC1 antibody was raised against the C terminal of CLIC1
- Purification
- Purified
- Immunogen
- CLIC1 antibody was raised using the C terminal of CLIC1 corresponding to a region with amino acids LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFAST
- Top Product
- Discover our top product CLIC1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CLIC1 Blocking Peptide, catalog no. 33R-5478, is also available for use as a blocking control in assays to test for specificity of this CLIC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLIC1 (Chloride Intracellular Channel 1 (CLIC1))
- Alternative Name
- CLIC1 (CLIC1 Products)
- Synonyms
- ncc27 antibody, xclic1 antibody, MGC75951 antibody, MGC132377 antibody, CLIC1 antibody, G6 antibody, NCC27 antibody, Clcp antibody, wu:fc30e04 antibody, zgc:77044 antibody, chloride intracellular channel 1 antibody, chloride intracellular channel 1 S homeolog antibody, clic1 antibody, CLIC1 antibody, Clic1 antibody, clic1.S antibody
- Background
- Chloride intracellular channel 1 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel1 encodes a protein that localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
- Molecular Weight
- 27 kDa (MW of target protein)
-