YARS antibody (C-Term)

Catalog No. ABIN630055

Product Details anti-YARS Antibody

Target: YARS (Yars) (Tyrosyl-tRNA Synthetase (Yars))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This YARS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: YARS antibody was raised against the C terminal of YARS

Purification: Purified

Immunogen: YARS antibody was raised using the C terminal of YARS corresponding to a region with amino acids QVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEE

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

YARS Blocking Peptide, catalog no. 33R-7770, is also available for use as a blocking control in assays to test for specificity of this YARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for YARS

Target: YARS (Yars) (Tyrosyl-tRNA Synthetase (Yars))

Alternative Name: YARS (Yars Products)

Synonyms: CMTDIC antibody, TYRRS antibody, YRS antibody, YTS antibody, AL024047 antibody, AU018965 antibody, cb204 antibody, wu:fk52b08 antibody, YARS antibody, cmtdic antibody, tyrrs antibody, yrs antibody, yts antibody, CG4561 antibody, Dmel\\CG4561 antibody, TyrRS antibody, anon-EST:Posey261 antibody, dYARS antibody, GB10789 antibody, tyrosyl-tRNA synthetase antibody, tyrosyl-tRNA synthetase L homeolog antibody, tyrosyl-tRNA synthetase, putative antibody, tyrosine--tRNA ligase antibody, Tyrosyl-tRNA synthetase antibody, tyrosine--tRNA ligase, cytoplasmic antibody, YARS antibody, Yars antibody, yars antibody, yars.L antibody, MAL8P1.125 antibody, MEFER_RS04475 antibody, TyrRS antibody, LOC413909 antibody, LOC100163888 antibody, LOC100282315 antibody

Background: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Tyrosyl-tRNA synthetase belongs to the class I tRNA synthetase family. Cytokine activities have also been observed for the human tyrosyl-tRNA synthetase, after it is split into two parts, an N-terminal fragment that harbors the catalytic site and a C-terminal fragment found only in the mammalian enzyme. The N-terminal fragment is an interleukin-8-like cytokine, whereas the released C-terminal fragment is an EMAP II-like cytokine.

Molecular Weight: 58 kDa (MW of target protein)