TMED4 antibody (N-Term)

Catalog No. ABIN630054

Product Details anti-TMED4 Antibody

Target: TMED4 (Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMED4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: TMED4 antibody was raised against the N terminal of TMED4

Purification: Purified

Immunogen: TMED4 antibody was raised using the N terminal of TMED4 corresponding to a region with amino acids LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMED4 Blocking Peptide, catalog no. 33R-5347, is also available for use as a blocking control in assays to test for specificity of this TMED4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMED4

Target: TMED4 (Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4))

Alternative Name: TMED4 (TMED4 Products)

Synonyms: TMED4 antibody, ERS25 antibody, HNLF antibody, 1110014L17Rik antibody, AI326346 antibody, fc88h09 antibody, wu:fc88h09 antibody, zgc:86755 antibody, ers25 antibody, hnlf antibody, RGD1306319 antibody, transmembrane p24 trafficking protein 4 antibody, transmembrane p24 trafficking protein 4 S homeolog antibody, TMED4 antibody, Tmed4 antibody, tmed4 antibody, tmed4.S antibody

Background: TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.

Molecular Weight: 25 kDa (MW of target protein)