APOO antibody (N-Term)
-
- Target See all APOO Antibodies
- APOO (Apolipoprotein O (APOO))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APOO antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM121 B antibody was raised against the N terminal Of Fam121
- Purification
- Purified
- Immunogen
- FAM121 B antibody was raised using the N terminal Of Fam121 corresponding to a region with amino acids PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL
- Top Product
- Discover our top product APOO Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM121B Blocking Peptide, catalog no. 33R-6980, is also available for use as a blocking control in assays to test for specificity of this FAM121B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM120 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOO (Apolipoprotein O (APOO))
- Alternative Name
- FAM121B (APOO Products)
- Synonyms
- fam121b antibody, fp74f12 antibody, wu:fp74f12 antibody, zgc:123314 antibody, my025 antibody, FAM121B antibody, 0610008C08Rik antibody, 1110019O03Rik antibody, RGD1565289 antibody, MGC79016 antibody, si:rp71-1f1.3 antibody, wu:fr42a11 antibody, zgc:103766 antibody, apolipoprotein O, a antibody, apolipoprotein O antibody, apolipoprotein O L homeolog antibody, apolipoprotein O, b antibody, apooa antibody, apoo antibody, APOO antibody, Apoo antibody, apoo.L antibody, apoob antibody
- Background
- FAM121B belongs to the FAM121 family and the function remains unknown.
- Molecular Weight
- 22 kDa (MW of target protein)
-